PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009783720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 830aa    MW: 94126.4 Da    PI: 5.6331
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009783720.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK505.9e-16641685448
          RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                      is ++l+++F +++ dAAk+Lgv  ++LKr CR y I RWP+ k
  XP_009783720.1 641 GISRSVLEEQFGKKLSDAAKSLGVARSTLKRMCRDYDIYRWPRSK 685
                     6999**************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151911.866623711IPR003035RWP-RK domain
Gene3DG3DSA:1.10.10.602.2E-4626677IPR009057Homeodomain-like
PfamPF020424.2E-13642685IPR003035RWP-RK domain
SuperFamilySSF542776.54E-17743828No hitNo description
SMARTSM006667.1E-16746829IPR000270PB1 domain
PROSITE profilePS5174519.571746830IPR000270PB1 domain
PfamPF005648.1E-15746828IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.9E-15747827No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 830 aa     Download sequence    Send to blast
MWPTQRTIKR NDGINRWVFW TQHNGDELNQ VKSLFPILRD STQPDTNGDC QLNRLTIKNL  60
VELLDVQGTC LIQFWSPIRN NGGKTFLTTA DQPFSFNGKI HEGLWAYRRV SLHTIASVDA  120
TEIDETKRIC VHGRPARVFR SGMPEFSPHV RYYYMDEYPL RNFAMCLGVG SYWTLPVFES  180
SGDRCIGVLE YAFEANVGLD LYSILDRLIN NHRILKTMGL ALIPSWLACP QEIQEVWEQE  240
LAQVKEALDV TCKTHMLLFA QTWIPVLDSS RTQMLITSPP TKYWSEEISS LEFLAVSDLH  300
HVQIGQGLVG KVLSSKGSCF CRDITQLSID FYPLVPIARC AGFTACFAIF VRLNSACHMV  360
LEFFLPRDEM LDRNPQSFLS KLLATIREQL PSFFLDSGPS LFVEVIRTAP VDELDSFEIN  420
QPQQVVRSKG NEKVVHFDSL NQDTADLGPS SSTDIGAHYM EITNHTPDNG EETVLQDSAH  480
KQGVEEADAM DKEKSSVHFK ENKFAYTDSD ILATSFVDSE QNLSTDKASL DEKLDSFKIG  540
HRQLPSMVQY NTINQIFGFD PSSSSDLEEI VTADYGRDTQ MNLQSKKRGE STQPDSAHQQ  600
TVEEADVADK RKHSVHVEEN TNSQNCPEKH KRIKRIEKEY GISRSVLEEQ FGKKLSDAAK  660
SLGVARSTLK RMCRDYDIYR WPRSKSANDV CSLSENKPVK RVEKQMGNSS REDLQLPHAS  720
LSNGMDTTTT LTQRKVPIAT FQSDNTMSVK VTYKDVTIRF PLSLSSGKID LETEVEKRLK  780
LVPVGSYSIK YEDEDNDWIA ITCDSDLEYG IHTLRSLGRT TMKMLVEPLN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009783720.10.0PREDICTED: protein NLP7-like isoform X2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.14e-46Nin-like family protein